PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013606530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 323aa    MW: 36299.8 Da    PI: 6.634
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013606530.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding621.2e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ede+lv++vk++G  +W++ ++  g++R++k+c++rw +yl
   XP_013606530.1 14 KGPWTPDEDEKLVKYVKKHGHSSWSALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding52.51.1e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ ++++++  G++ W+tIa+ ++ gRt++++k++w+++l
   XP_013606530.1  67 RGKFSPEEEQTILNLHAVVGNK-WSTIANNLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.572961IPR017930Myb domain
SuperFamilySSF466891.76E-3111108IPR009057Homeodomain-like
SMARTSM007176.0E-161363IPR001005SANT/Myb domain
PfamPF002495.9E-181461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-251568IPR009057Homeodomain-like
CDDcd001674.82E-131661No hitNo description
PROSITE profilePS5129426.54962116IPR017930Myb domain
SMARTSM007171.1E-1566114IPR001005SANT/Myb domain
PfamPF002492.7E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2769117IPR009057Homeodomain-like
CDDcd001677.16E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MGRSPSSGES GLKKGPWTPD EDEKLVKYVK KHGHSSWSAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SPEEEQTILN LHAVVGNKWS TIANNLPGRT DNEIKNFWNT HLKKKLIQMG  120
VDPMTHRPRT DVLSSLSQLI SLSSNLRGFV DQEQIMLKLQ TEMAKLELFQ YLLQPPSMYN  180
NINPNDFDTP SLLNSIASTT SNNLDLGSYI QDFNSLPSLK NLNTNIGPSS VFPQNLDANH  240
FKFFNQRENL LISPSWLSDP SSSNQSLLPS LDPSSVMTDD LIRSQYVIED VNSNLTSSSY  300
QESGASAAWP DHLLDDSIFF DIP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-30121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1553440.0AC155344.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH080A08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013606523.10.0PREDICTED: myb-related protein Hv1-like
RefseqXP_013606524.10.0PREDICTED: myb-related protein Hv1-like
RefseqXP_013606525.10.0PREDICTED: myb-related protein Hv1-like
RefseqXP_013606526.10.0PREDICTED: myb-related protein Hv1-like
RefseqXP_013606527.10.0PREDICTED: myb-related protein Hv1-like
RefseqXP_013606528.10.0PREDICTED: myb-related protein Hv1-like
RefseqXP_013606529.10.0PREDICTED: myb-related protein Hv1-like
RefseqXP_013606530.10.0PREDICTED: myb-related protein Hv1-like
SwissprotQ8GWP02e-68MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0D3EGI30.0A0A0D3EGI3_BRAOL; Uncharacterized protein
STRINGBra009044.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10280.11e-166myb domain protein 92